DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and SPCC4G3.12c

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_587826.1 Gene:SPCC4G3.12c / 2539364 PomBaseID:SPCC4G3.12c Length:821 Species:Schizosaccharomyces pombe


Alignment Length:242 Identity:49/242 - (20%)
Similarity:82/242 - (33%) Gaps:61/242 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SHDETTPN----DNQSPQISEIADEVVENEQVVASTSSYSRQMTWANAPEFVPRYKA--NSADFQ 85
            :|..||.|    ..|..::|........:..::   |:.:|:.:.|.:..|..:...  |::||.
pombe   605 THQPTTDNTSSFSTQPGRLSTGLHHFPSDRDLL---SNQTRRSSLARSYRFEEQLSVDDNTSDFS 666

  Fly    86 --ATEGVQDI------------CPYGGSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHN- 135
              |:.|..|:            ..:|...|:.....:|.|..:.....|:..:||.::...... 
pombe   667 TLASNGAADMVTQTHSEGTFSNSTHGDWLIYVFGGLFPEHHPVLSTVSLFSDNPMYEDLLALTTY 731

  Fly   136 ----RECLEQHEQAMELSFAIARSKD------KMCGICFDTVVE----KKGRERRFGILSKCKHI 186
                ::.:..||.........|...|      ..|.||.:|...    :|        |..|||.
pombe   732 LGPAKKPVASHEDVKRSGGLFAYFDDASLSSADSCLICLETYTNGDICRK--------LQACKHF 788

  Fly   187 FCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCPSAYWVDTKEEKD 233
            |...||..|.      .|....||.||         |:.|.|:.|::
pombe   789 FHQACIDQWL------TTGNNSCPLCR---------AHGVTTQAEEE 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 1/2 (50%)
PHA03096 <80..239 CDD:222981 39/183 (21%)
RING 159..213 CDD:238093 16/57 (28%)
SPCC4G3.12cNP_587826.1 zf-RING_2 764..809 CDD:290367 16/58 (28%)
zf-rbx1 <764..809 CDD:289448 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.