DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and SPCC1739.01

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_588409.2 Gene:SPCC1739.01 / 2539315 PomBaseID:SPCC1739.01 Length:547 Species:Schizosaccharomyces pombe


Alignment Length:108 Identity:28/108 - (25%)
Similarity:40/108 - (37%) Gaps:22/108 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SYRRSQTICRFHLLGICRFGDLCRFSH----DETTPNDNQSPQI---------SEIADEVVENEQ 53
            |....:.||::.|.|.|:||..|..||    :...||...:..:         |.:|.:.:...|
pombe    66 SLETERPICKYFLKGNCKFGPKCALSHALPGNTNLPNGTSTNTMASMAANGGASSVASKQMGANQ 130

  Fly    54 VVASTSSYSRQMTWANAPEFVPRYKANSADFQATEGVQDICPY 96
            :..|.||    .|..|     |..|||:.......|.....||
pombe   131 ISPSLSS----KTMKN-----PADKANNTTATDVRGNTATSPY 164

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 10/29 (34%)
PHA03096 <80..239 CDD:222981 4/17 (24%)
RING 159..213 CDD:238093