DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and ccch-1

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_505926.2 Gene:ccch-1 / 179584 WormBaseID:WBGene00009532 Length:460 Species:Caenorhabditis elegans


Alignment Length:98 Identity:26/98 - (26%)
Similarity:38/98 - (38%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FHLLGICRFGDLCRFSHDETTPNDNQSPQISEIADEVVENEQVVASTSSYSRQMTWANAPEFVPR 76
            ||..|.|.:|..|.|.|:|  |...||...:.|:..|...    .:.|.|:.|.......:..|.
 Worm   245 FHQSGYCPYGPRCHFIHNE--PPSAQSQYSTPISTPVPHQ----TTPSLYASQYHNVTMKQQQPT 303

  Fly    77 YKANSADFQATEGVQDICPYGGSCIWGSKCSYP 109
            ..|::......:.|..: |.||   :||....|
 Worm   304 QNASNVPNNVLQRVYSL-PNGG---YGSAGESP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 8/17 (47%)
PHA03096 <80..239 CDD:222981 7/30 (23%)
RING 159..213 CDD:238093
ccch-1NP_505926.2 CTH1 <19..263 CDD:227395 8/17 (47%)
zf-CCCH 199..225 CDD:279036
zf-CCCH 237..263 CDD:279036 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3270
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.