DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5347 and DTX3L

DIOPT Version :9

Sequence 1:	NP_572970.1	Gene:	CG5347 / 32403	FlyBaseID:	FBgn0030578	Length:	285	Species:	Drosophila melanogaster
Sequence 2:	NP_612144.1	Gene:	DTX3L / 151636	HGNCID:	30323	Length:	740	Species:	Homo sapiens

Alignment Length:	71	Identity:	25/71 - (35%)
Similarity:	34/71 - (47%)	Gaps:	20/71 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   144 QAMELSFAIARSKDK-MCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTR 207
            :|.||.     .|:| :|.||.||:..||       :|.||||.||..||   .:|..::..
Human   549 EASELD-----KKEKGICVICMDTISNKK-------VLPKCKHEFCAPCI---NKAMSYKPI--- 595

  Fly   208 GCPECR 213
             ||.|:
Human   596 -CPTCQ 600

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5347	NP_572970.1	ZnF_C3H1	4..30	CDD:214632
		PHA03096	<80..239	CDD:222981	25/71 (35%)
		RING	159..213	CDD:238093	19/53 (36%)
DTX3L	NP_612144.1	RRM1_PAR14	8..86	CDD:240746
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	96..119
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	195..231
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	524..551		0/1 (0%)
		RING-HC_DTX3L	560..600	CDD:319626	19/53 (36%)
		RING-HC finger (C3HC4-type)	561..599	CDD:319626	19/51 (37%)
		Deltex_C	608..738	CDD:193607
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910