powered by:
Protein Alignment CG5347 and AgaP_AGAP002028
DIOPT Version :9
Sequence 1: | NP_572970.1 |
Gene: | CG5347 / 32403 |
FlyBaseID: | FBgn0030578 |
Length: | 285 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_321026.4 |
Gene: | AgaP_AGAP002028 / 1281089 |
VectorBaseID: | AGAP002028 |
Length: | 615 |
Species: | Anopheles gambiae |
Alignment Length: | 54 |
Identity: | 16/54 - (29%) |
Similarity: | 24/54 - (44%) |
Gaps: | 11/54 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 160 CGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECR 213
|.||.:..||.: |..:| .|:|.:...||..|...:: |.||.|:
Mosquito 258 CAICLEDFVENE----RLRVL-PCRHAYHAICIDPWLTKNR------RVCPICK 300
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.