DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5347 and AgaP_AGAP002028

DIOPT Version :9

Sequence 1:	NP_572970.1	Gene:	CG5347 / 32403	FlyBaseID:	FBgn0030578	Length:	285	Species:	Drosophila melanogaster
Sequence 2:	XP_321026.4	Gene:	AgaP_AGAP002028 / 1281089	VectorBaseID:	AGAP002028	Length:	615	Species:	Anopheles gambiae

Alignment Length:	54	Identity:	16/54 - (29%)
Similarity:	24/54 - (44%)	Gaps:	11/54 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   160 CGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECR 213
            |.||.:..||.:    |..:| .|:|.:...||..|...::      |.||.|:
Mosquito   258 CAICLEDFVENE----RLRVL-PCRHAYHAICIDPWLTKNR------RVCPICK 300

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5347	NP_572970.1	ZnF_C3H1	4..30	CDD:214632
		PHA03096	<80..239	CDD:222981	16/54 (30%)
		RING	159..213	CDD:238093	15/52 (29%)
AgaP_AGAP002028	XP_321026.4	PA_C_RZF_like	51..197	CDD:239038
AgaP_AGAP002028	XP_321026.4	zf-RING_2	256..300	CDD:290367	15/52 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910