DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and AgaP_AGAP011656

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_320855.3 Gene:AgaP_AGAP011656 / 1280981 VectorBaseID:AGAP011656 Length:96 Species:Anopheles gambiae


Alignment Length:118 Identity:30/118 - (25%)
Similarity:47/118 - (39%) Gaps:32/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FSHDETTPNDNQSPQISEIADEVVENEQVVASTSSYSRQMTWANAPEFVPRYKANSADFQATEGV 90
            :|.:..|.:|:.|.| :|.|:          ::.:|:      |..|..|      .|....|  
Mosquito     4 YSSEPDTSSDDSSDQ-AETAE----------TSGNYN------NIQELDP------TDLDHAE-- 43

  Fly    91 QDICPYGGSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNRECLEQHE 143
            ||     ..|........|  .|:|:.|..|||.|.|:.||:.|:..|..:|:
Mosquito    44 QD-----EECFATGDPEVP--FEMCRQCGAYCLDPTDEGQRQIHHAHCSLEHQ 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 1/3 (33%)
PHA03096 <80..239 CDD:222981 19/64 (30%)
RING 159..213 CDD:238093
AgaP_AGAP011656XP_320855.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.