DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and TMC6

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001120670.1 Gene:TMC6 / 11322 HGNCID:18021 Length:805 Species:Homo sapiens


Alignment Length:159 Identity:31/159 - (19%)
Similarity:50/159 - (31%) Gaps:55/159 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 MTWANAPEFVPRYKANSADFQATEGVQDICPYGGSCIWGSKCSYPLHMEICKMCDLYCLHPMDQN 129
            :.::.|..|...|:..|     |.|:..|..:   |.|..|.:......            :.|:
Human   358 LVYSMAHSFGESYRVGS-----TSGIHAITVF---CSWDYKVTQKRASR------------LQQD 402

  Fly   130 QRRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRT 194
            ..|...:|.|.:        :.:..|...:|           ||.|:..:|.    :..|.|:.|
Human   403 NIRTRLKELLAE--------WQLRHSPRSVC-----------GRLRQAAVLG----LVWLLCLGT 444

  Fly   195 WRQAHQFEATVTRGCP-ECRVFSEFVCPS 222
                       ..||. ...|||||:..|
Human   445 -----------ALGCAVAVHVFSEFMIQS 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632
PHA03096 <80..239 CDD:222981 28/144 (19%)
RING 159..213 CDD:238093 10/54 (19%)
TMC6NP_001120670.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
TMC 540..646 CDD:400250
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 778..805
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.