DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and mkrn1

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_004912513.1 Gene:mkrn1 / 100485650 XenbaseID:XB-GENE-959144 Length:451 Species:Xenopus tropicalis


Alignment Length:302 Identity:130/302 - (43%)
Similarity:164/302 - (54%) Gaps:44/302 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSQTICRFHLLGICRFGDLCRFSHDETTPND------------NQSP-----QISEIADEVVENE 52
            ||..|||:...|.|.:||.||:.|.:....|            ::||     .|:..|.|:..:|
 Frog    64 RSTMICRYFQRGCCAYGDRCRYEHTKPLKEDLIGNTSTARSWPSESPAEPSSNINSKAAELAASE 128

  Fly    53 QVVASTSSYSRQMTWANAPEFVP--RYKANSADFQATEGVQ----------------DICPYG-- 97
            .......:..    |.||.||||  .|...:.| ..|:|.|                .:|||.  
 Frog   129 LAAGGPQAED----WVNAVEFVPGQLYSGRAPD-AYTQGTQKEDECREQPADPELKKQLCPYAAV 188

  Fly    98 GSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNRECLEQHEQAMELSFAIARSKDKMCGI 162
            |.|.:|..|.| ||.:.|.||.|..|||:|..||..|.:.|:|.||:.||||||:.||||.:|||
 Frog   189 GECRYGENCVY-LHGDPCDMCGLQVLHPVDTAQRSQHIKSCIEAHEKDMELSFAVQRSKDIVCGI 252

  Fly   163 CFDTVVEKKG-RERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCPSAYWV 226
            |.:.|.||.. .||||||||.|.|.:||.|||.||.|.|||:.:.:.|||||:.|.||.||.|||
 Frog   253 CMEVVYEKTNPGERRFGILSNCSHSYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWV 317

  Fly   227 DTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFYRH 268
            :.||||.||:.:|:.||..|.|:||:.|.|.||||..|||:|
 Frog   318 EEKEEKQKLIQKYKEAMSNKSCRYFDEGRGTCPFGGNCFYKH 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 12/24 (50%)
PHA03096 <80..239 CDD:222981 86/177 (49%)
RING 159..213 CDD:238093 31/54 (57%)
mkrn1XP_004912513.1 YTH1 <35..>92 CDD:227416 12/27 (44%)
zf-CCCH_4 68..87 CDD:375512 9/18 (50%)
PHA03096 <190..339 CDD:222981 82/149 (55%)
RING-HC_MKRN1_3 247..307 CDD:319644 34/59 (58%)
RING-HC finger (C3HC4-type) 250..303 CDD:319644 30/52 (58%)
MKRN1_C 369..436 CDD:374139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8364
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32175
Inparanoid 1 1.050 251 1.000 Inparanoid score I3142
OMA 1 1.010 - - QHG58455
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 1 1.000 - - mtm9499
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2178
SonicParanoid 1 1.000 - - X837
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.