DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5334 and AT1G13195

DIOPT Version :10

Sequence 1:NP_572969.1 Gene:CG5334 / 32402 FlyBaseID:FBgn0030577 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_563922.1 Gene:AT1G13195 / 837878 AraportID:AT1G13195 Length:260 Species:Arabidopsis thaliana


Alignment Length:115 Identity:35/115 - (30%)
Similarity:50/115 - (43%) Gaps:27/115 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ISNNADEV----VG-HANRYSRPMTGANATEEMKLSFAIA-KSQDKMCGICLETVVKKRGRECRF 100
            :.:|.||:    :| ...|.|:.:|    .|.....|:.| ..:::.|||||||..|.       
plant   119 LHSNLDELETTDIGFDLKRLSKKIT----KEARSSRFSNAGLEREEECGICLETCTKM------- 172

  Fly   101 GILPKCKHIFCLTCIRRWRQAEYIEDNVK-RGCPECRVFSEFVCPSAYWV 149
             :||.|.|..|:.|.|.|        |:| :.||.||...:.|.....||
plant   173 -VLPNCCHSMCIKCYRNW--------NLKSQSCPFCRGSMKRVNSEDLWV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5334NP_572969.1 RING-HC_MKRN 81..136 CDD:438184 20/55 (36%)
AT1G13195NP_563922.1 COG5540 <98..200 CDD:227827 30/100 (30%)
RING_Ubox 161..200 CDD:473075 20/54 (37%)

Return to query results.
Submit another query.