DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5334 and AIRP2

DIOPT Version :10

Sequence 1:NP_572969.1 Gene:CG5334 / 32402 FlyBaseID:FBgn0030577 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_195772.1 Gene:AIRP2 / 831747 AraportID:AT5G01520 Length:242 Species:Arabidopsis thaliana


Alignment Length:117 Identity:33/117 - (28%)
Similarity:47/117 - (40%) Gaps:32/117 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RYSRPMTGANATEEMKLSFAIAKSQDKMCGICLETVVKKRGRECRFGILPKCKHIFCLTCIRRWR 119
            ||.:    .:.|::.|:| .|...:::.||||||...|.        :||.|.|..|:.|.|.||
plant   123 RYRK----KDRTDKGKMS-EIDLEREEECGICLEIRNKV--------VLPTCNHSMCINCYRNWR 174

  Fly   120 QAEYIEDNVKRGCPECRVFSEFVCPSAYWVDT------------KEEKDKLL 159
            ..       .:.||.||...:.|.....|:.|            ||...:||
plant   175 AR-------SQSCPFCRGSLKRVNSGDLWIYTCSAEIADLPAIYKENLKRLL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5334NP_572969.1 RING-HC_MKRN 81..136 CDD:438184 18/54 (33%)
AIRP2NP_195772.1 RING_Ubox 145..184 CDD:473075 18/53 (34%)
HRD1 <146..238 CDD:227568 27/89 (30%)

Return to query results.
Submit another query.