DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15890 and AT2G16980

DIOPT Version :9

Sequence 1:NP_001285245.1 Gene:CG15890 / 32401 FlyBaseID:FBgn0030576 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001324580.1 Gene:AT2G16980 / 816201 AraportID:AT2G16980 Length:477 Species:Arabidopsis thaliana


Alignment Length:363 Identity:75/363 - (20%)
Similarity:133/363 - (36%) Gaps:72/363 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 ILIPVVGEFLGVVGL--MLCVYFEQAPMEAAALTEAIFPSLSGGW---------FTMLMGVFSYI 221
            :::||:|......|:  ||.:     ||..:.|..||.     |:         |.::..:|..:
plant    81 VMMPVIGNLSDRYGIKAMLTL-----PMCLSVLPPAIL-----GYRRDTNFFYAFYVIKTLFDMV 135

  Fly   222 ----------ADITTEEDRTLRIGILNVCFSVGVPIGMAFSGVLLKQIGFYGVFSISAAFYVIAF 276
                      |.:......|.||.:..:...|....|:..| :..:.:.....|.::|....|..
plant   136 CQGTIDCLANAYVAKNVHGTKRISMFGILAGVSSISGVCAS-LSARFLSIASTFQVAAISLFIGL 199

  Fly   277 VYGFFFLEEPQSRPEKSAEQKS---------------------LLADFFDKEHVVQTFRVAFKKG 320
            ||...||:|.....:...|..|                     :|.|...|.||..:...::|..
plant   200 VYMRVFLKERLQDADDDDEADSGGCRSHQEVHNGGDLKMLTEPILRDAPTKTHVFNSKYSSWKDM 264

  Fly   321 ENQRRKRVILLMIVVMVIIGPL--HGEMAVTYLFTRFRFNWSEVEFSFFSTYAMFTGLIGVIFCV 383
            .:......||:..:|:......  .|..:....|.:.||.:::.:|:.........|.|..:|.:
plant   265 VSLINNSTILIQALVVTFFATFSESGRGSALMYFLKARFGFNKNDFAELFLLVTIIGSISQLFIL 329

  Fly   384 GILSHKLNIDDALVGVLSSTSKILSSF---VYAFATLPWHMYLGGLVEIFNGTAFI--AMRSIAT 443
            ..||..:.....|     ||..::..|   ..:.|..||..|  .:..:..|..|:  ::..||:
plant   330 PTLSSTIGERKVL-----STGLLMEFFNATCLSVAWSPWVPY--AMTMLVPGAMFVMPSVCGIAS 387

  Fly   444 KLVSKDELGKVNS-LFGV---AEALMPMVFAPMYTTLY 477
            :.|...|.|||.. :.||   |:.:.|.|::|: |.|:
plant   388 RQVGSSEQGKVQGCISGVRAFAQVVAPFVYSPL-TALF 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15890NP_001285245.1 MFS 135..507 CDD:119392 75/363 (21%)
MFS_1 135..470 CDD:284993 72/354 (20%)
AT2G16980NP_001324580.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.