DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NetB and USHBP1

DIOPT Version :9

Sequence 1:NP_001162753.1 Gene:NetB / 32400 FlyBaseID:FBgn0015774 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_001308346.1 Gene:USHBP1 / 83878 HGNCID:24058 Length:703 Species:Homo sapiens


Alignment Length:124 Identity:28/124 - (22%)
Similarity:44/124 - (35%) Gaps:38/124 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 ATTPPQQPPKVTPPGKVTP----------------PSTAAPSAAASAVTL-PISQHYAVSDFAVG 402
            ||.|..:..:..|||::.|                ||.|.|..::....| |:.:   ||...:|
Human     5 ATRPRSRRGRHAPPGELDPVAESSEEVEAASGSSKPSFAPPPVSSGLEQLGPMEE---VSGQGLG 66

  Fly   403 GRC--KCNGHASECVATVSSGSGTALSDQDDGQDEDTPSAPSLANHFGRSTQMSAKLTM 459
            .|.  |.:|           |||..|:..     .:.|..|::..|......:..|.|:
Human    67 SRTDKKMDG-----------GSGRELASA-----PEVPHKPAVEAHQAPEAALQYKETV 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NetBNP_001162753.1 LamNT 37..261 CDD:214532
EGF_Lam <458..484 CDD:238012 1/2 (50%)
EGF_Lam 498..555 CDD:238012
EGF_Lam 560..608 CDD:238012
NTR_netrin-1_like 661..791 CDD:239634
USHBP1NP_001308346.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113 28/124 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..172
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..256
MCC-bdg_PDZ 299..363 CDD:287477
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..416
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 540..583
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3512
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.