DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NetB and dsd

DIOPT Version :9

Sequence 1:NP_001162753.1 Gene:NetB / 32400 FlyBaseID:FBgn0015774 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_001263013.1 Gene:dsd / 43315 FlyBaseID:FBgn0039528 Length:1323 Species:Drosophila melanogaster


Alignment Length:315 Identity:73/315 - (23%)
Similarity:106/315 - (33%) Gaps:130/315 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 STAAPSAAASAV-TLPISQHYAVSDF----------AVGGRCKCNGHASECVATVSSGSGTALSD 428
            |||:|...|..: :.|||:.|.||..          :....|:.:...:.|.:..|.| |.||:.
  Fly   748 STASPPLNAKHLDSCPISEEYLVSSVCDQLHNCRACSANLACRWDSEHNRCKSYTSYG-GLALNR 811

  Fly   429 QDDGQDE--DTPSAPSLAN----------------------------HFGRSTQMSAKLTMTCAC 463
            .   |||  .:||..||.|                            .:|:..:.:   |.|..|
  Fly   812 T---QDEVACSPSCASLTNCQNCTEDECIWCQNEQRCVDRNAYTASFPYGQCREWT---TFTAKC 870

  Fly   464 K----HNTA---GP-------------ECERCKPFYFDRPWGRATDNDAN--------------- 493
            :    .:||   |.             .|:.|    .|.|.....||.:|               
  Fly   871 RSAPIQSTALAVGSTTALSSAQCGYYNSCQMC----LDDPACGWCDNGSNTGLGRCVVGGALAPY 931

  Fly   494 -------------ECKMCQCNGHA-----RRCRFNLELYKLSGRVSGGVCYNCQHDTTGRYCHYC 540
                         .|..|.||||:     :.|.                 ..|.:.|||.:|..|
  Fly   932 DDTECALKHWFFTSCPRCNCNGHSYCNDQQHCE-----------------QPCNNLTTGAHCEKC 979

  Fly   541 REGYYRDATKPPNHRKVCKRCDCHPVGSTGKTCNHLSGQCPC-KEGVTGLTCNRC 594
            |.||:.:   |.|..| |:||||:   ..|..|:..:|:|.| .:|:.|..|.:|
  Fly   980 RTGYWGN---PINGGK-CQRCDCN---GQGVYCHPDTGKCFCTTKGIVGDHCEKC 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NetBNP_001162753.1 LamNT 37..261 CDD:214532
EGF_Lam <458..484 CDD:238012 9/45 (20%)
EGF_Lam 498..555 CDD:238012 17/61 (28%)
EGF_Lam 560..608 CDD:238012 13/36 (36%)
NTR_netrin-1_like 661..791 CDD:239634
dsdNP_001263013.1 CUB 86..212 CDD:238001
PLN02153 290..582 CDD:177814
KELCH repeat 308..349 CDD:276965
Kelch_5 355..391 CDD:290565
KELCH repeat 358..420 CDD:276965
KELCH repeat 424..474 CDD:276965
KELCH repeat 482..531 CDD:276965
KELCH repeat 535..588 CDD:276965
PSI 821..870 CDD:279745 7/51 (14%)
EGF_Lam 948..994 CDD:238012 18/66 (27%)
EGF_Lam 995..1040 CDD:238012 13/36 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10574
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.