Sequence 1: | NP_001162753.1 | Gene: | NetB / 32400 | FlyBaseID: | FBgn0015774 | Length: | 793 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001263013.1 | Gene: | dsd / 43315 | FlyBaseID: | FBgn0039528 | Length: | 1323 | Species: | Drosophila melanogaster |
Alignment Length: | 315 | Identity: | 73/315 - (23%) |
---|---|---|---|
Similarity: | 106/315 - (33%) | Gaps: | 130/315 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 375 STAAPSAAASAV-TLPISQHYAVSDF----------AVGGRCKCNGHASECVATVSSGSGTALSD 428
Fly 429 QDDGQDE--DTPSAPSLAN----------------------------HFGRSTQMSAKLTMTCAC 463
Fly 464 K----HNTA---GP-------------ECERCKPFYFDRPWGRATDNDAN--------------- 493
Fly 494 -------------ECKMCQCNGHA-----RRCRFNLELYKLSGRVSGGVCYNCQHDTTGRYCHYC 540
Fly 541 REGYYRDATKPPNHRKVCKRCDCHPVGSTGKTCNHLSGQCPC-KEGVTGLTCNRC 594 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NetB | NP_001162753.1 | LamNT | 37..261 | CDD:214532 | |
EGF_Lam | <458..484 | CDD:238012 | 9/45 (20%) | ||
EGF_Lam | 498..555 | CDD:238012 | 17/61 (28%) | ||
EGF_Lam | 560..608 | CDD:238012 | 13/36 (36%) | ||
NTR_netrin-1_like | 661..791 | CDD:239634 | |||
dsd | NP_001263013.1 | CUB | 86..212 | CDD:238001 | |
PLN02153 | 290..582 | CDD:177814 | |||
KELCH repeat | 308..349 | CDD:276965 | |||
Kelch_5 | 355..391 | CDD:290565 | |||
KELCH repeat | 358..420 | CDD:276965 | |||
KELCH repeat | 424..474 | CDD:276965 | |||
KELCH repeat | 482..531 | CDD:276965 | |||
KELCH repeat | 535..588 | CDD:276965 | |||
PSI | 821..870 | CDD:279745 | 7/51 (14%) | ||
EGF_Lam | 948..994 | CDD:238012 | 18/66 (27%) | ||
EGF_Lam | 995..1040 | CDD:238012 | 13/36 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45445155 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR10574 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |