DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5321 and AT3G21360

DIOPT Version :9

Sequence 1:NP_001285244.1 Gene:CG5321 / 32399 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_188773.1 Gene:AT3G21360 / 821690 AraportID:AT3G21360 Length:330 Species:Arabidopsis thaliana


Alignment Length:324 Identity:70/324 - (21%)
Similarity:111/324 - (34%) Gaps:111/324 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KQQEYLRDFYRPTTRHWSGA------------EFQDIAQHFSYDEVMSQDSVLMQWLQALAIYGV 174
            |.|::    |..:..|.|||            :|.|:.:.|.:||              |...|.
plant    48 KTQKH----YLDSLLHESGAVLFRGFPVNSADDFNDVVEAFGFDE--------------LPYVGG 94

  Fly   175 ALLRGAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYEYKPSV 239
            |    ||                |.:..|..|.....|..|.       :|.|.::......||.
plant    95 A----AP----------------RTSVVGRVFTANESPPDQK-------IPFHHEMAQVREFPSK 132

  Fly   240 NILHCVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLS-------RIVVDWNDIGSEDGREFH 297
            ...:|.::... ||...:|....|.:.::..|||..:||.       |::.:.:|..|..||.  
plant   133 LFFYCEIEPKC-GGETPIVLSHVVYERMKDKHPEFVQRLEEHGLLYVRVLGEDDDPSSPIGRG-- 194

  Fly   298 NIWRAPVICLDEEGRYTRINHSVPQRDSHFNVPLEEVLPWYESYALFVRLAIADSHAFKTRPGDV 362
              |::..:..|:        :...||.....:.||    |.|           |..| ||..|.:
plant   195 --WKSTFLTHDK--------NLAEQRAVDLGMKLE----WTE-----------DGGA-KTVMGPI 233

  Fly   363 ------------LTFNNIRLLHGRTGYDDSEESPRYIV----GAYLDWDIIYSRLRVLKKRLTA 410
                        :.||:  ::...||::|....||..|    |..|..||::..||:|::...|
plant   234 PAIKYDESRNRKVWFNS--MVAAYTGWEDKRNDPRKAVTFGDGKPLPADIVHDCLRILEEECVA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847
carnitine_bodg 49..405 CDD:274118 68/317 (21%)
CAS_like 127..395 CDD:238154 62/302 (21%)
AT3G21360NP_188773.1 CAS_like 14..330 CDD:294121 70/324 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D868657at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.