DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5321 and CG4335

DIOPT Version :9

Sequence 1:NP_001285244.1 Gene:CG5321 / 32399 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_650886.1 Gene:CG4335 / 42421 FlyBaseID:FBgn0038795 Length:364 Species:Drosophila melanogaster


Alignment Length:371 Identity:104/371 - (28%)
Similarity:169/371 - (45%) Gaps:30/371 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SKPLTFPGIWLRDNCMCEDCFHGSSKSRKLDWDNFDTRIRPVSLQTDEQSKEVLVKWSDAHESRF 108
            |:.:.....||||:|.|.:|.:..:..|:.|..:....|.|:.::.|..:.:  |:|||||:|.:
  Fly    10 SQSIEINEFWLRDHCRCVECLNFETNQRRYDVLDLPADIMPLDVKYDGMNLQ--VQWSDAHKSNY 72

  Fly   109 SLKWLKERCFEPDKQQEYL--RDFYRPTTRHWSGAEFQDIAQH--FSYDEVMSQDSVLMQWLQAL 169
            .|.::.      |.|.|.|  |.........|:.:......:|  |...:::|.|:.:...:::|
  Fly    73 DLDFIF------DSQLERLIGRRSKSTNLTPWNRSIILQNERHLRFPLPQLVSSDNEVRSLVESL 131

  Fly   170 AIYGVALLRGAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYE 234
            ..||:..:........:......||..:.:|.:||.:.....|...:.||..|.|..|||..|:.
  Fly   132 VRYGIVFIDDVAPTANMTELALRRVFPLMKTFFGEMWTFSDNPDHADTAYTKLYLGSHTDNTYFC 196

  Fly   235 YKPSVNILHCVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHNI 299
            ....:..|||:..:.| ||.|..|||.||...|:|.:|..::.|..:.|....|  |.|.  |:.
  Fly   197 DAAGLQALHCIEHSGS-GGENFFVDGLHVVHELKRRYPAAYDVLCSVQVPGEYI--EKGE--HHY 256

  Fly   300 WRAPVICLD---EEGRYTRINHSVPQRDSHFNVPLEEVLPWYESYALFVRLAIADSH---AFKTR 358
            ..||:|.:|   :|....|:|  |..|.....:|..|:..:|:|....: |.:.|..   |.|..
  Fly   257 HTAPIIQVDPLTQEFVQLRLN--VYDRAVFNTIPQAEMAEFYDSLRQLL-LIVRDKQQQWALKLC 318

  Fly   359 PGDVLTFNNIRLLHGRTGYDDSEESPRYIVGAYLDWDIIYSRLRVL 404
            ||.::.|:|.|:||||..|..|    |.:.|:|:......|:.|||
  Fly   319 PGSIVLFDNWRVLHGREAYTGS----RTMSGSYVQRTDFLSKARVL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 20/64 (31%)
carnitine_bodg 49..405 CDD:274118 103/366 (28%)
CAS_like 127..395 CDD:238154 76/277 (27%)
CG4335NP_650886.1 carnitine_TMLD 19..361 CDD:274119 103/362 (28%)
DUF971 <19..70 CDD:294847 18/52 (35%)
CAS_like 110..350 CDD:294121 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457821
Domainoid 1 1.000 69 1.000 Domainoid score I2287
eggNOG 1 0.900 - - E1_COG2175
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I1572
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D534559at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10696
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2023
SonicParanoid 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.