DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NetA and ntng1a

DIOPT Version :9

Sequence 1:NP_001285243.1 Gene:NetA / 32398 FlyBaseID:FBgn0015773 Length:726 Species:Drosophila melanogaster
Sequence 2:XP_009295804.2 Gene:ntng1a / 569075 ZFINID:ZDB-GENE-091118-13 Length:545 Species:Danio rerio


Alignment Length:539 Identity:163/539 - (30%)
Similarity:235/539 - (43%) Gaps:125/539 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YNKAHEPRAC-IPDFVNAAYDAPVVASSTCGSSGAQRYCEYQDHERSCHTCD-MTDPLRSFPARS 103
            |..|.:|.|. :..::....|.|.:   |||.. .:.||..::.....:.|| .||.| :.|...
Zfish    46 YYMACQPEAADMTKYLKVTLDPPNI---TCGDP-PETYCTLENPYMCNNECDAATDEL-AHPPEL 105

  Fly   104 LTDLNNSNNVTCWRS-------EPVTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYK 161
            :.|:...|..|.|:|       :|:.     |.:|||..|..|||..|: :...:.||:.||:.|
Zfish   106 MFDIVGRNPTTFWQSTSWKKYPKPLA-----VNITLSWNKTIELTDDIV-ITFESGRPEQMVLEK 164

  Fly   162 STDHGLSWQPFQFFSSQCRRLFGRPAR--QSTGRHNEHEARC-----------SDVTRPLVSRIA 213
            |.|:|.||||:||:::.|...|....:  :...:|...:..|           :|.|.....|..
Zfish   165 SLDYGRSWQPYQFYATDCLDAFTMEPKTMKDITQHTLLDIICTEEYSRGYVWKNDKTVRFEIRDR 229

  Fly   214 FSTLEGRPSSRD-------LDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGK 271
            |:...| |...:       ||::..|:|:.|.||:|:   ||.||         |.|||.:..  
Zfish   230 FALFAG-PKLHNMASLYGQLDTTKNLRDFFTITDLRI---RLLRP---------ATGATMVDE-- 279

  Fly   272 YSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSH 336
                       ||:            |..:|||||..|.||||||.||:.|..|.. :|.|||.|
Zfish   280 -----------NNL------------SRYYYAISDIKVHGRCKCNLHANSCIYDKE-KLTCECEH 320

  Fly   337 NTAGRDCERCKPFHFDRPWARAT-----AKEANECK-------ECNCNKHARQCRFNMEIFRLSQ 389
            ||.|.||.|||.....|.|:..:     ...||.|.       .|.|..|:.:|.: :|:     
Zfish   321 NTTGPDCGRCKRNFQARAWSAGSYLPIPKGTANICMANYAGPVNCECYNHSNRCSY-IEV----- 379

  Fly   390 GVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSGKICNSTSGQCPCK 454
             ::..:|.:|:|:|.|::||.||.|:||:||.......:|..|:|:|.||....||.| |.|.||
Zfish   380 -LNAVICVSCKHNTRGQHCHLCKLGYYRNATAKPDDENICIDCNCNPFGSESDRCNGT-GYCRCK 442

  Fly   455 DGVTGLTCNRCARGYQ-----QSR---SHIAPC-----------IKQPPRMINMLDTQNTAPEPD 500
            :|.||..|:.|..||.     :||   |.:..|           .:.||....:|      .|..
Zfish   443 EGATGAMCHECLPGYLWDNGCKSRVCDSELLRCQNGGVCVNYVRCQCPPAYTGLL------CEKP 501

  Fly   501 EPESSPGS-GGDRNGAAGM 518
            ..|..||. ||..:|.|.:
Zfish   502 RCEKEPGGCGGSDSGQASL 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NetANP_001285243.1 LamNT 44..280 CDD:214532 71/264 (27%)
EGF_Lam 312..357 CDD:238012 24/44 (55%)
EGF_Lam 369..426 CDD:238012 19/56 (34%)
EGF_Lam 431..479 CDD:238012 22/55 (40%)
NTR_netrin-1_like 545..723 CDD:239634
ntng1aXP_009295804.2 Laminin_N 69..296 CDD:306548 75/275 (27%)
EGF_Lam 297..343 CDD:238012 24/46 (52%)
EGF_Lam 355..413 CDD:238012 20/64 (31%)
EGF_Lam 421..468 CDD:238012 21/47 (45%)
EGF_CA <475..499 CDD:238011 4/29 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.