DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NetA and Ushbp1

DIOPT Version :9

Sequence 1:NP_001285243.1 Gene:NetA / 32398 FlyBaseID:FBgn0015773 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_001028859.1 Gene:Ushbp1 / 290629 RGDID:1310859 Length:680 Species:Rattus norvegicus


Alignment Length:209 Identity:40/209 - (19%)
Similarity:62/209 - (29%) Gaps:76/209 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 LDTQNTAPEPDEPESSPGSGGDRNGAAG-----------MAAQSQYYRTEGGR------ECGKCR 537
            |.||..:||....|...|.      ..|           :.|..|.|:   ||      :.||..
  Rat   270 LSTQRPSPEMYLMEDQMGQ------LQGNIEKLKCFNRLLLAVLQGYK---GRCESLSIKLGKRE 325

  Fly   538 VSTKRLNL----NKFCKRDYAIM---------AKVIGRDTSSEAVSREVQRRAMDPDVADYEMDQ 589
            .....|:|    :|.|:..|.::         |.|...:...:|..:|..|..:..:|       
  Rat   326 AEATALHLALQYSKDCEEVYEVLLALKTAGLGAGVGATNGDLQAAEKEASRLLVKKEV------- 383

  Fly   590 VQPGSARSPITGVYEFQAADYPNPNPNPRGSEMERFDLQIQAVFKRSRPGESSGAGNVYGMPNTT 654
                             |.|...|.|:|.||.::             :|.....|..::|.....
  Rat   384 -----------------AMDVKTPQPSPEGSSVD-------------KPTPEELAAQLHGYVQHL 418

  Fly   655 LKRGPMTWIIPTKD 668
            .:|..:..|.|..|
  Rat   419 RERWALLKIPPVLD 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NetANP_001285243.1 LamNT 44..280 CDD:214532
EGF_Lam 312..357 CDD:238012
EGF_Lam 369..426 CDD:238012
EGF_Lam 431..479 CDD:238012
NTR_netrin-1_like 545..723 CDD:239634 24/137 (18%)
Ushbp1NP_001028859.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..101
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..162
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..250
MCC-bdg_PDZ 288..352 CDD:287477 13/72 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 524..562
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3512
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.