DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NetA and Ushbp1

DIOPT Version :9

Sequence 1:NP_001285243.1 Gene:NetA / 32398 FlyBaseID:FBgn0015773 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_852083.2 Gene:Ushbp1 / 234395 MGIID:1922920 Length:680 Species:Mus musculus


Alignment Length:236 Identity:46/236 - (19%)
Similarity:72/236 - (30%) Gaps:64/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 RDATKPLTHRK------------VCKACDCHPIGSSGKICNSTSGQC-------------PCKDG 456
            |..|||..|::            :.:.||   :||...:..|...||             |...|
Mouse    37 RFETKPELHQEYLGP
GLQSPRNWIKEGCD---VGSHAVLSLSPEEQCEPEVEAHQVLQEAPLDSG 98

  Fly   457 VTGLTCNRCARGYQ---QSRSHIAPCIKQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGM 518
            ...::........|   .|...:...::.     :.|....:....|..:.:||..||....||.
Mouse    99 PAEISVPSVYETLQCRLSSLEAVVAALRH-----HSLSFPKSVEAEDRDQGAPGPFGDEKEDAGP 158

  Fly   519 AAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAI---MAKVIGRDTSSEAVSREVQRRAMDP 580
            ..|......|        |.:..||.|   |.|:..:   .|.:.......|.:.|:||      
Mouse   159 GQQEAARLIE--------RNAWLRLAL---CNREDELACTQASLQDAQAEKETLQRQVQ------ 206

  Fly   581 DVADYEMDQVQPGSARSPITGVYEFQAADYPNPNPNPRGSE 621
                 |::........||.|.:..   |...|.|.:..|:|
Mouse   207 -----ELEDSLMQMEASPPTPILR---AGRRNSNSSTSGAE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NetANP_001285243.1 LamNT 44..280 CDD:214532
EGF_Lam 312..357 CDD:238012
EGF_Lam 369..426 CDD:238012 4/8 (50%)
EGF_Lam 431..479 CDD:238012 11/63 (17%)
NTR_netrin-1_like 545..723 CDD:239634 17/80 (21%)
Ushbp1NP_852083.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 5/13 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..161 7/26 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..247 6/23 (26%)
MCC-bdg_PDZ 288..352 CDD:287477
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 384..405
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 524..549
BAR <585..>655 CDD:299863
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3512
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.