DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NetA and ntng2b

DIOPT Version :9

Sequence 1:NP_001285243.1 Gene:NetA / 32398 FlyBaseID:FBgn0015773 Length:726 Species:Drosophila melanogaster
Sequence 2:XP_009293374.1 Gene:ntng2b / 101885039 ZFINID:ZDB-GENE-110502-1 Length:1579 Species:Danio rerio


Alignment Length:514 Identity:100/514 - (19%)
Similarity:163/514 - (31%) Gaps:175/514 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 HGLSWQPFQFFSSQCRRLFGRPARQSTGRHNEHEARCSDVTRPLVSRIAFSTLEGRPSSRDLD-- 227
            ||....|           .|..|......||.|    ..|..|..|       ..:|...:.:  
Zfish  1128 HGSEHNP-----------HGSEANPHGSEHNSH----GSVANPHGS-------GHKPHGSEYNPH 1170

  Fly   228 ---SSPVLQDWVTATDIRVVFHRLQRP-----DPQALLSLEAGGATDLASGKY-----------S 273
               ::|::.::.|...:       ..|     :|...::...|...|....:|           |
Zfish  1171 GSVANPLVSEYNTHGSV-------ANPHGSAHNPHGSVANPHGSGHDPHGSEYNPHGSVENPQGS 1228

  Fly   274 VPLANGPAGN---NIE------ANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQ 329
            .|.::|...|   ::|      .|..|.||......|.:....:.......|.|.|..:...||.
Zfish  1229 APNSHGSVANPHGSVENPHASAHNSHGSVANPHGSAHNSHGSVASPHGSAHNSHGSGHNPHGSGH 1293

  Fly   330 LNCECSHNTAGRDCERCKPF-------------------------HFDRPWARATAKEA------ 363
            ...|..|.|.|   .|.||.                         |...|.:..|..|:      
Zfish  1294 NPHESGHKTHG---PRHKPHGSVVYPHEPMHNPHGHLHNEPKSESHGPIPESARTTDESVLPISA 1355

  Fly   364 -----------------------------------------------NECKECNCNKHARQCRFN 381
                                                           ::.::|.||.|:.:|.: 
Zfish  1356 LESDPNIEMVSIHMSPEEKKEGYTHKALMKFLLSGGKQTVQLKGIIYDDFQDCECNGHSNRCSY- 1419

  Fly   382 MEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSGKICNS 446
            ::...:.      .|.:|:|:|.|:||..|:..:|::.:.......||..|:|:.:||....||.
Zfish  1420 IDFLNIV------TCVSCKHNTRGQNCEHCRMSYYKNMSAEPDDENVCIECNCNALGSVHDRCNG 1478

  Fly   447 TSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMIN--MLDTQN--TAPEPDEPESSPG 507
            | |.|.||:|.||:.|:.|..||...:.    |:   |.:.:  :|..||  |..:......:|.
Zfish  1479 T-GFCQCKEGTTGVKCDECLPGYYWKQG----CL---PNVCDDELLLCQNGGTCVQNQRCICTPD 1535

  Fly   508 SGGDRNGAAGMAAQSQYYRTEGGRECGKCRVSTKRLNLN-KFCKRDYAIMAKVIGRDTS 565
            ..|         ...|:.|.|.|::|.  ..|..||:|. ..|    .::|.::|...|
Zfish  1536 FKG---------VLCQHSRCEEGKKCN--GASALRLSLALLLC----PLLATLLGSTAS 1579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NetANP_001285243.1 LamNT 44..280 CDD:214532 21/135 (16%)
EGF_Lam 312..357 CDD:238012 14/69 (20%)
EGF_Lam 369..426 CDD:238012 14/56 (25%)
EGF_Lam 431..479 CDD:238012 18/47 (38%)
NTR_netrin-1_like 545..723 CDD:239634 5/22 (23%)
ntng2bXP_009293374.1 EGF_Lam <3..34 CDD:238012
EGF_CA 1408..1457 CDD:304395 14/55 (25%)
Laminin_EGF 1464..1511 CDD:278482 20/54 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.