DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NetA and ushbp1

DIOPT Version :9

Sequence 1:NP_001285243.1 Gene:NetA / 32398 FlyBaseID:FBgn0015773 Length:726 Species:Drosophila melanogaster
Sequence 2:XP_005155764.1 Gene:ushbp1 / 100148935 ZFINID:ZDB-GENE-121024-2 Length:649 Species:Danio rerio


Alignment Length:256 Identity:53/256 - (20%)
Similarity:91/256 - (35%) Gaps:67/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 GLTCNRCARGYQQSRSHIAPCIKQP-----PRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGM 518
            |::|:........|....:||...|     |    :|..:..:..||.|  .|.|..|      .
Zfish   224 GVSCSPPVSPSLSSSRTSSPCFSSPSYPGSP----LLSRKLPSSRPDSP--LPPSTID------S 276

  Fly   519 AAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAIMAKVIGRDTSSEAVSREVQRRAMDPDVA 583
            ..|::   ||..:.|           |.:...|:..:.|.::.|...||.:|..:.|:..|....
Zfish   277 VLQAE---TEKMQRC-----------LERLKARNERLSAALVRRKGESEQLSMSLSRQEADSSAL 327

  Fly   584 DYEMDQVQP-GSARSPITGVYEFQ----AADYPNPNPNPRGSEMERFDLQIQAVFKRSRPGESSG 643
            ...:...:. ..|.|.:..:||.:    ||....|.|:...|:.|      .:..:.|.|.|  |
Zfish   328 HMALAYCEECEEAYSDLLSLYEARKQQHAATNSTPQPDLSKSKEE------NSKCESSSPPE--G 384

  Fly   644 AGNVYGMPNTTLKR------GPMTWIIPTKDLECRCPRIRVNRSYLIL------GRDSEAP 692
            |.:  ..||:..|:      |.:|.         |..|::.:|:.:.:      |.|..:|
Zfish   385 AAD--ARPNSLSKQEFEDKAGVITQ---------RISRLQQDRAAVCIPQRGKAGEDKISP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NetANP_001285243.1 LamNT 44..280 CDD:214532
EGF_Lam 312..357 CDD:238012
EGF_Lam 369..426 CDD:238012
EGF_Lam 431..479 CDD:238012 3/19 (16%)
NTR_netrin-1_like 545..723 CDD:239634 35/165 (21%)
ushbp1XP_005155764.1 MCC-bdg_PDZ 284..348 CDD:287477 12/74 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3512
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.