DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sbm and CG5535

DIOPT Version :9

Sequence 1:NP_727785.1 Gene:sbm / 32397 FlyBaseID:FBgn0030574 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster


Alignment Length:430 Identity:102/430 - (23%)
Similarity:170/430 - (39%) Gaps:70/430 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RKPLERNGSTQNHVVHLERRLGLFSGVALIVGTMIGSGIFVSPSGLLVRTG--SVGVSFIIWLAC 126
            :||||.:..::     |.:.|..|...||.:|:.:|.|::|....:..:..  :|.|||:|   .
  Fly    25 KKPLEDSNESK-----LAKVLSAFDLTALGIGSTLGVGVYVLAGEVSKQYAGPAVVVSFLI---A 81

  Fly   127 GVLSLLGALAYAELGTMNTSSGAEWAYFMDAYGPAPAFLFSWVSTLVLKPSQMAIICLSFAQYAV 191
            .:.|:...|.|||.|.....:|:.:.|.....|...|||..|  .|:|             :||:
  Fly    82 AIASIFAGLCYAEFGARVPKAGSAYIYSYVTIGEFIAFLIGW--NLIL-------------EYAI 131

  Fly   192 -EAFVTE---------CDPP-------------RGVVKMVALVA-IVMILFVNCYSVNL--GMAV 230
             .|.|.:         |..|             .|:.....|.| :|.|||....:|..  ...|
  Fly   132 GSASVVKGLSTYLDQLCGNPMSSFLGTHMPLNIEGMGAYPDLFAFVVTILFSLAIAVGAKESTRV 196

  Fly   231 QNVFTAAKLVAVVVVICGGAWKLMQGN----TQHLSNAF--NGPMP-NVGAI----ATAFYTGLW 284
            .||||...|..|:.||..|.:|:...|    ...:...:  .|.|| .|..|    |..||    
  Fly   197 NNVFTMLNLGVVLFVIIAGLFKVSSSNWSIPKSQVPEGYGDGGFMPYGVSGIIKGAAVCFY---- 257

  Fly   285 AYDGWNNLNYVTEEIKNPSKNLPRSIIIGIPLVTLCYALINISYLAAMSPQEMIESEAVAVTFGN 349
            .:.|::.:....||.|||.|::|.::|:.:.::.|.|  ..:|.:..|......:.|...:....
  Fly   258 GFIGFDCIATAGEEAKNPKKSIPFAVIVSLAMIFLAY--FGVSTVLTMMLPYFEQDEKAPLPHVF 320

  Fly   350 RILG--ALAWLMPLSVTISTFGSANGTLFAAGRLCFAASREGHLLDILSYVHVRRLTPAPGLIFH 412
            ||.|  ...:::.:........|..|.:|...|:.||.|.:|.|...|..:..:..||..|.:..
  Fly   321 RINGWHVAEYVVSIGAMFGLCSSMMGAMFPLPRIVFAMSNDGLLFKFLGDISEKYKTPFKGTMIT 385

  Fly   413 SLIASAMVLHGTIDSLIDFFSFTAWIFYGGAMLALIVMRY 452
            .::...:.....:..|::..|....:.|......::::||
  Fly   386 GMLTGILAAVFNLSQLVNMMSIGTLLAYSMVASCVLMLRY 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sbmNP_727785.1 2A0308 53..532 CDD:273332 102/430 (24%)
CG5535NP_649019.2 2A0303 20..585 CDD:273330 102/430 (24%)
AA_permease_C 535..585 CDD:290617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.