DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sbm and LOC100150834

DIOPT Version :9

Sequence 1:NP_727785.1 Gene:sbm / 32397 FlyBaseID:FBgn0030574 Length:541 Species:Drosophila melanogaster
Sequence 2:XP_021322470.1 Gene:LOC100150834 / 100150834 -ID:- Length:230 Species:Danio rerio


Alignment Length:223 Identity:79/223 - (35%)
Similarity:133/223 - (59%) Gaps:9/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 KNLPRSIIIGIPLVTLCYALINISYLAAMSPQEMIESEAVAVTFGNRILGALAWLMPLSVTISTF 368
            :|||.:|.:.:|:||:.|.|.|::|.|.:.....:.|:||||||||::||.:.|::|::|.:|.:
Zfish     8 RNLPIAIAVSMPIVTIIYLLTNVAYYAVLDMPSFMGSDAVAVTFGNQVLGPINWIVPIAVAMSCY 72

  Fly   369 GSANGTLFAAGRLCFAASREGHLLDILSYVHVRRLTPAPGLIFHSLIASAMVLHGTIDSLIDFFS 433
            |..|.::.||.||.|..:|||||...||.:|..|.||.|.|:|:.::....:....:..||::||
Zfish    73 GGLNASIIAASRLFFVGAREGHLPISLSLIHTERYTPVPALLFNCVMGLVFLCVEDVFQLINYFS 137

  Fly   434 FTAWIFYGGAMLALIVMRYTKPNYPRPYKVPIIIPVVVLVISVYLVAAPIFETPRVEYLYALLFI 498
            |:.|:|.|.::..||.:|.|:|:..||.|:.:..|.|..:.||:||..|:: :..:..|..:...
Zfish   138 FSYWLFVGLSVAGLIYLRITQPDRHRPVKLSLFFPFVYCLCSVFLVIVPLY-SDTINSLIGIAIA 201

  Fly   499 FAG-----LIFYVPFVKLGMTPRFMNKV 521
            .:|     |..|:|..|   .|:::.|:
Zfish   202 LSGVPVYYLCVYLPKEK---RPKWIGKL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sbmNP_727785.1 2A0308 53..532 CDD:273332 79/223 (35%)
LOC100150834XP_021322470.1 AA_permease_2 <8..223 CDD:330980 78/218 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D621852at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.