DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sbm and arhgap6

DIOPT Version :9

Sequence 1:NP_727785.1 Gene:sbm / 32397 FlyBaseID:FBgn0030574 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001106502.2 Gene:arhgap6 / 100127692 XenbaseID:XB-GENE-976843 Length:800 Species:Xenopus tropicalis


Alignment Length:89 Identity:20/89 - (22%)
Similarity:33/89 - (37%) Gaps:28/89 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 WKLMQGNTQHLSNAFNGPMPNVGAI------ATAFYTGLWAY----------DGWNNLNYVTEEI 299
            ||.|.|.:..|.:.   |:.::..:      ..|||.....|          ||......:.:::
 Frog    19 WKSMSGRSVRLKSV---PIQSLSELERARLQEVAFYRLQQDYDLNCQITIPKDGQKRKKSLRKKL 80

  Fly   300 ------KNPSKN-LPRSIIIGIPL 316
                  ||..|. ||::  .|:||
 Frog    81 DSLGKEKNKDKEFLPQA--FGMPL 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sbmNP_727785.1 2A0308 53..532 CDD:273332 20/89 (22%)
arhgap6NP_001106502.2 RhoGAP_ARHGAP6 220..431 CDD:239841
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.