DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and Nme3

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_445959.1 Gene:Nme3 / 85269 RGDID:619879 Length:169 Species:Rattus norvegicus


Alignment Length:135 Identity:43/135 - (31%)
Similarity:67/135 - (49%) Gaps:3/135 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMN 66
            |.|...:||..::.....:.:|....:.|.::..|.|..::||....|.|.:.:.||.||..:|.
  Rat    22 ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELRERPFYSRLVKYMG 86

  Fly    67 SGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREIS 131
            |||..|::.|....::..|:|:|.|....|.   |..||..:.:...:|..|||||..||.|||:
  Rat    87 SGPVVAMVWQGLDVVRASRALIGATDPGDAT---PGTIRGDFCVEVGKNVIHGSDSVESAQREIA 148

  Fly   132 ILFPE 136
            :.|.|
  Rat   149 LWFRE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 43/135 (32%)
NDPk6 2..135 CDD:239877 41/132 (31%)
Nme3NP_445959.1 NDK 22..156 CDD:278749 43/135 (32%)
NDPk_I 22..151 CDD:239876 41/131 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.