DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and AT1G17410

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_173184.2 Gene:AT1G17410 / 838313 AraportID:AT1G17410 Length:181 Species:Arabidopsis thaliana


Alignment Length:135 Identity:49/135 - (36%)
Similarity:73/135 - (54%) Gaps:0/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMN 66
            |.|||:|||..:...|..:....::...|.|:.:....:.||.:..||.||..:.|:..|.::|.
plant    33 ERTLAMIKPDGVSGNYTEEIKTIVVEAGFNIVKEMLTQLDKETASAFYEEHSSRSFFPHLVTYMT 97

  Fly    67 SGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREIS 131
            |||...::|:....:..||.|:|||...:|..|.|:.||||.|.:..:|..|||||.:||.|||.
plant    98 SGPVLVMVLEKRNAVSDWRDLIGPTDAEKAKISHPHSIRALCGKNSQKNCVHGSDSTSSAEREIK 162

  Fly   132 ILFPE 136
            ..|.:
plant   163 FFFKD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 49/135 (36%)
NDPk6 2..135 CDD:239877 48/132 (36%)
AT1G17410NP_173184.2 PLN02931 1..181 CDD:215503 49/135 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I2549
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I2244
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto4242
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46161
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.