DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and Nme5

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_542368.2 Gene:Nme5 / 75533 MGIID:1922783 Length:211 Species:Mus musculus


Alignment Length:135 Identity:53/135 - (39%)
Similarity:82/135 - (60%) Gaps:2/135 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFM 65
            :|.|||||||.|:.....:|.|  ::...|||:.::::.::.|....||.|..||.|:..||::|
Mouse    12 VEKTLALIKPDVVDKEEEIQDI--ILGSGFTIIQRRKLHLSPEHCSNFYVEQYGKMFFPNLTAYM 74

  Fly    66 NSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREI 130
            :|||..|:||.....|..|:.|:||:....|..:.|:.:||:||..:.|||.|||:..|::.|||
Mouse    75 SSGPLVAMILARHKAISYWKELMGPSNSLVAKETHPDSLRAIYGTDELRNALHGSNDFAASEREI 139

  Fly   131 SILFP 135
            ..:||
Mouse   140 RFMFP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 53/134 (40%)
NDPk6 2..135 CDD:239877 51/132 (39%)
Nme5NP_542368.2 NDK 13..148 CDD:197791 53/134 (40%)
NDPk5 13..144 CDD:239880 51/132 (39%)
Dpy-30 156..197 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.