DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and Nme9

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001159429.1 Gene:Nme9 / 623534 MGIID:4359686 Length:263 Species:Mus musculus


Alignment Length:147 Identity:49/147 - (33%)
Similarity:72/147 - (48%) Gaps:4/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSG 68
            ||.:|||..:.:..|.:.|..:....|.||.::|..:|:...:.||.....:..:.||...|.||
Mouse   100 TLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQHRAREEAFERLVHHMCSG 164

  Fly    69 PSYALILQ----SETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALRE 129
            ||:.|||.    :|..:..||:.|||.....|....|..:||.||.....||.|||.....|.||
Mouse   165 PSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTEMPFNAVHGSRDREDANRE 229

  Fly   130 ISILFPEFDAAVGSRQA 146
            :::|||.|..:...::|
Mouse   230 LALLFPSFKFSDKDKEA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 47/137 (34%)
NDPk6 2..135 CDD:239877 45/134 (34%)
Nme9NP_001159429.1 Thioredoxin_like 1..>67 CDD:294274
NDPk_TX 98..234 CDD:239879 44/133 (33%)
NDK 99..239 CDD:197791 48/138 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.