DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and nme6

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_571672.2 Gene:nme6 / 58120 ZFINID:ZDB-GENE-000710-3 Length:175 Species:Danio rerio


Alignment Length:139 Identity:69/139 - (49%)
Similarity:93/139 - (66%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFM 65
            :::|||:|||..:.:...::.:...|.:||.|:.:|::...|..||.|||||.|:||:.||..||
Zfish     7 LQLTLAVIKPDAMAHPLILEALHQKILENFIIIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFM 71

  Fly    66 NSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREI 130
            :|||..|.||..|..|..||:::||||||||.:|.|..:|..||::||||..|||||..||.|||
Zfish    72 SSGPMRAYILAREDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKREI 136

  Fly   131 SILFPEFDA 139
            |..||||.|
Zfish   137 SFFFPEFSA 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 67/135 (50%)
NDPk6 2..135 CDD:239877 64/132 (48%)
nme6NP_571672.2 NDK 8..144 CDD:197791 67/135 (50%)
NDPk6 8..141 CDD:239877 64/132 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574248
Domainoid 1 1.000 138 1.000 Domainoid score I4811
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4231
Inparanoid 1 1.050 144 1.000 Inparanoid score I4430
OMA 1 1.010 - - QHG52103
OrthoDB 1 1.010 - - D1395365at2759
OrthoFinder 1 1.000 - - FOG0006199
OrthoInspector 1 1.000 - - oto39071
orthoMCL 1 0.900 - - OOG6_107208
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5730
SonicParanoid 1 1.000 - - X4479
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.700

Return to query results.
Submit another query.