DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and Nme4

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_006524740.1 Gene:Nme4 / 56520 MGIID:1931148 Length:223 Species:Mus musculus


Alignment Length:150 Identity:37/150 - (24%)
Similarity:61/150 - (40%) Gaps:20/150 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMN 66
            |.||..:||..::.......|:....:.|.::..|.:...:.:....|.:.:.|.||..|.|:|:
Mouse    57 ERTLVAVKPDGVQRRLVGTVIQRFERRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPALISYMS 121

  Fly    67 SGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGI-----------------SDTR 114
            |||..|::.:....:...|:::|.|....|.   |..||..:.:                 ...|
Mouse   122 SGPVVAMVWEGPNVVHISRAMIGHTDSTEAA---PGTIRGDFSVHISSACRSQKRVLDAWSQSYR 183

  Fly   115 NACHGSDSEASALREISILF 134
            |..|.|||...|.|||.:.|
Mouse   184 NVIHASDSVDGAQREIELWF 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 36/149 (24%)
NDPk6 2..135 CDD:239877 36/149 (24%)
Nme4XP_006524740.1 NDPk_I 57..203 CDD:239876 36/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.