DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and Nme6

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_061227.1 Gene:Nme6 / 54369 MGIID:1861676 Length:189 Species:Mus musculus


Alignment Length:151 Identity:69/151 - (45%)
Similarity:94/151 - (62%) Gaps:6/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEITLALIKPHVLRNTYAMQQI-RALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSF 64
            :::|||||||..:.:...::.: :.::|..|.|:..:|:....|...|||.||:|:|||.||..|
Mouse    11 LQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRTRELQWKLEDCRRFYREHEGRFFYQRLVEF 75

  Fly    65 MNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALRE 129
            |.|||..|.||..:..||.||:|:|||:||||.|..|:.||...|::||||..|||||..||.||
Mouse    76 MTSGPIRAYILAHKDAIQLWRTLMGPTRVFRARYIAPDSIRGSLGLTDTRNTTHGSDSVVSASRE 140

  Fly   130 ISILFPEFDAAVGSRQAKREE 150
            |:..||:|     |.|...||
Mouse   141 IAAFFPDF-----SEQRWYEE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 64/136 (47%)
NDPk6 2..135 CDD:239877 62/133 (47%)
Nme6NP_061227.1 NDPk6 12..146 CDD:239877 62/133 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831282
Domainoid 1 1.000 125 1.000 Domainoid score I5475
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4231
Inparanoid 1 1.050 129 1.000 Inparanoid score I4640
Isobase 1 0.950 - 0 Normalized mean entropy S1899
OMA 1 1.010 - - QHG52103
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 1 1.000 - - FOG0006199
OrthoInspector 1 1.000 - - oto93609
orthoMCL 1 0.900 - - OOG6_107208
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5730
SonicParanoid 1 1.000 - - X4479
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.750

Return to query results.
Submit another query.