DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and nme3

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_012825767.1 Gene:nme3 / 448695 XenbaseID:XB-GENE-999215 Length:188 Species:Xenopus tropicalis


Alignment Length:133 Identity:42/133 - (31%)
Similarity:66/133 - (49%) Gaps:3/133 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMN 66
            |.|...|||...:.....:.||....:.|.::..|.:..:::|.::.|...:.|.||.||..:|.
 Frog    41 ERTFLAIKPDGYQRRLIGEIIRRFEKKGFHLVAMKIMQASEQLLKQHYIALQDKPFYDRLVKYMG 105

  Fly    67 SGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREIS 131
            |||..|::.|....::..|.::|.|   ...:|.|..||..:.:...||..|||||..||.|||:
 Frog   106 SGPVVAMVWQGLDVVKTARLMIGET---NPAHSLPGTIRGDFCVDVGRNVIHGSDSRESAQREIA 167

  Fly   132 ILF 134
            :.|
 Frog   168 LWF 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 42/133 (32%)
NDPk6 2..135 CDD:239877 42/133 (32%)
nme3XP_012825767.1 NDPk 41..187 CDD:260363 42/133 (32%)
NDK 41..175 CDD:278749 42/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.