DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and nme5

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001002516.1 Gene:nme5 / 436789 ZFINID:ZDB-GENE-040718-221 Length:217 Species:Danio rerio


Alignment Length:135 Identity:55/135 - (40%)
Similarity:84/135 - (62%) Gaps:2/135 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFM 65
            :|.|||||||..:..|..::.|  ::...||||.::.:.::.|....|||||.||..:..||:||
Zfish    17 VERTLALIKPDAIHKTDEIEDI--ILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFM 79

  Fly    66 NSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREI 130
            :|||..||.|..:..|..|::::||....:|..:.|:|:||.:|..|.|||.|||::.::|.|||
Zfish    80 SSGPVVALALARDQAIATWKAIMGPVSSIKARETHPDCLRARFGTCDLRNAVHGSETFSAAEREI 144

  Fly   131 SILFP 135
            ..:||
Zfish   145 RFMFP 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 55/134 (41%)
NDPk6 2..135 CDD:239877 53/132 (40%)
nme5NP_001002516.1 NDK 18..153 CDD:278749 55/134 (41%)
NDPk5 18..149 CDD:239880 53/132 (40%)
Dpy-30 161..202 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.