DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and nme7

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_988903.1 Gene:nme7 / 394498 XenbaseID:XB-GENE-987403 Length:376 Species:Xenopus tropicalis


Alignment Length:146 Identity:58/146 - (39%)
Similarity:74/146 - (50%) Gaps:2/146 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMN 66
            |.|||||||..:....::  |.|::...|.|...|.|.:.:..:..||.||..|.|:..|.|||.
 Frog    92 EKTLALIKPDAVTKMGSI--IEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMT 154

  Fly    67 SGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREIS 131
            |||..|:.:..:..:..||.|||||....|....|..|||.:|...|:||.|||||.|||.||:.
 Frog   155 SGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELE 219

  Fly   132 ILFPEFDAAVGSRQAK 147
            ..||..........||
 Frog   220 FFFPSSGGRAPKNTAK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 56/135 (41%)
NDPk6 2..135 CDD:239877 54/132 (41%)
nme7NP_988903.1 DUF1126 6..91 CDD:391643
NDPk7A 92..222 CDD:239878 54/131 (41%)
NDPk7B 238..371 CDD:239875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.