DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and Nme8

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_942087.2 Gene:Nme8 / 364729 RGDID:735069 Length:596 Species:Rattus norvegicus


Alignment Length:133 Identity:48/133 - (36%)
Similarity:72/133 - (54%) Gaps:1/133 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSG 68
            ||||||||| .:...|:.::|:....|.:...||:.:|.|.:.:.|.:..||.||..:...::||
  Rat   460 TLALIKPHV-SHKERMEILKAIRDARFELTQMKEMHLTPEHASKVYFKITGKDFYKNVLDVLSSG 523

  Fly    69 PSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREISIL 133
            .|..:||.....:.:||.::||.....|....||.:||.|||...|||.||:.:.:.|...||.:
  Rat   524 MSVVMILTKWNAVGEWRRMMGPVDPEEAKLLSPNSLRARYGIDVLRNAVHGASNMSEAATAISNV 588

  Fly   134 FPE 136
            |.|
  Rat   589 FTE 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 48/133 (36%)
NDPk6 2..135 CDD:239877 46/130 (35%)
Nme8NP_942087.2 TRX_NDPK 11..113 CDD:239246
NDPk_TX 155..311 CDD:239879
NDK 2 322..462 1/1 (100%)
NDPk_TX 323..455 CDD:239879
NDPk 458..589 CDD:238335 46/129 (36%)
NDK 3 463..596 45/130 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.