DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and nme7

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_571004.2 Gene:nme7 / 30086 ZFINID:ZDB-GENE-000210-35 Length:374 Species:Danio rerio


Alignment Length:134 Identity:48/134 - (35%)
Similarity:71/134 - (52%) Gaps:2/134 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMN 66
            |.|||:|||..:.....:  |:.:...|..:...|...:|.:.:..||.||:.|.|::.|..|::
Zfish    90 ERTLAMIKPDAVSKVGDI--IQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVS 152

  Fly    67 SGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREIS 131
            |||..|:.|..:..:..||.:||||....|.....:.:|..:|...|:||.|||||.|||.||:.
Zfish   153 SGPVIAMELMGDEAVSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTKNAGHGSDSLASAARELE 217

  Fly   132 ILFP 135
            ..||
Zfish   218 YFFP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 48/134 (36%)
NDPk6 2..135 CDD:239877 46/132 (35%)
nme7NP_571004.2 DM10 1..89 CDD:128921
NDPk7A 90..220 CDD:239878 46/131 (35%)
NDPk7B 236..369 CDD:239875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.