DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and AT4G23895

DIOPT Version :10

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001190817.1 Gene:AT4G23895 / 2745723 AraportID:AT4G23895 Length:467 Species:Arabidopsis thaliana


Alignment Length:145 Identity:46/145 - (31%)
Similarity:74/145 - (51%) Gaps:20/145 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEITLALIKPHVLRNTYAMQQIRALISQNFTILDQK-------EVCI-TKELSERFYAEHKGKFF 57
            ||.|...|||..::        |.|||:..|..::|       :|.: :|..:::.|.:.|.:.|
plant   317 MERTFIAIKPDGVQ--------RGLISEIITRFERKGYKLVGIKVMVPSKGFAQKHYHDLKERPF 373

  Fly    58 YHRLTSFMNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDS 122
            ::.|.:|::|||..|::.:.|..|:..|.|:|.|...:   |:|..||....:...||..||||.
plant   374 FNGLCNFLSSGPVVAMVWEGEGVIRYGRKLIGATDPQK---SEPGTIRGDLAVVVGRNIIHGSDG 435

  Fly   123 EASALREISILF-PE 136
            ..:|..|||:.| ||
plant   436 PETAKDEISLWFKPE 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDPk6 2..135 CDD:239877 43/141 (30%)
AT4G23895NP_001190817.1 PH 147..227 CDD:214574
PLN02619 237..467 CDD:178228 46/145 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.