DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and Nme7

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_036018403.1 Gene:Nme7 / 171567 MGIID:2449121 Length:408 Species:Mus musculus


Alignment Length:146 Identity:51/146 - (34%)
Similarity:77/146 - (52%) Gaps:2/146 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMN 66
            |.|||||||..:  :.|.:.|..:....|||...:.:.:|::.:..|:.:|..:.||:.|..|:.
Mouse   124 EKTLALIKPDAV--SKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFIT 186

  Fly    67 SGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREIS 131
            |||..|:.:..:..|.:|:.||||.....:....|..||||:|....|||.||.|:.|||.||:.
Mouse   187 SGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREME 251

  Fly   132 ILFPEFDAAVGSRQAK 147
            :.||.......:..||
Mouse   252 LFFPSSGGCGPANTAK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 49/135 (36%)
NDPk6 2..135 CDD:239877 47/132 (36%)
Nme7XP_036018403.1 DM10 35..123 CDD:128921
NDPk7A 124..254 CDD:239878 47/131 (36%)
NDPk7B 270..403 CDD:239875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.