DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and NME6

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_024309066.1 Gene:NME6 / 10201 HGNCID:20567 Length:336 Species:Homo sapiens


Alignment Length:54 Identity:29/54 - (53%)
Similarity:38/54 - (70%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGS 120
            |||..|.||..:..||.||:|:|||:||||.:..|:.||..:|::||||..|||
Human   156 SGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 29/54 (54%)
NDPk6 2..135 CDD:239877 29/54 (54%)
NME6XP_024309066.1 DNA_pol3_gamma3 <24..>132 CDD:331207
NDPk <155..209 CDD:320914 27/52 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141341
Domainoid 1 1.000 129 1.000 Domainoid score I5274
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4231
Inparanoid 1 1.050 133 1.000 Inparanoid score I4612
Isobase 1 0.950 - 0 Normalized mean entropy S1899
OMA 1 1.010 - - QHG52103
OrthoDB 1 1.010 - - D1395365at2759
OrthoFinder 1 1.000 - - FOG0006199
OrthoInspector 1 1.000 - - oto90033
orthoMCL 1 0.900 - - OOG6_107208
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5730
SonicParanoid 1 1.000 - - X4479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.650

Return to query results.
Submit another query.