Sequence 1: | NP_572965.1 | Gene: | nmdyn-D6 / 32396 | FlyBaseID: | FBgn0030573 | Length: | 151 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024309066.1 | Gene: | NME6 / 10201 | HGNCID: | 20567 | Length: | 336 | Species: | Homo sapiens |
Alignment Length: | 54 | Identity: | 29/54 - (53%) |
---|---|---|---|
Similarity: | 38/54 - (70%) | Gaps: | 0/54 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 SGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGS 120 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nmdyn-D6 | NP_572965.1 | NDK | 2..138 | CDD:197791 | 29/54 (54%) |
NDPk6 | 2..135 | CDD:239877 | 29/54 (54%) | ||
NME6 | XP_024309066.1 | DNA_pol3_gamma3 | <24..>132 | CDD:331207 | |
NDPk | <155..209 | CDD:320914 | 27/52 (52%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165141341 | |
Domainoid | 1 | 1.000 | 129 | 1.000 | Domainoid score | I5274 |
eggNOG | 1 | 0.900 | - | - | E1_COG0105 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H4231 | |
Inparanoid | 1 | 1.050 | 133 | 1.000 | Inparanoid score | I4612 |
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S1899 |
OMA | 1 | 1.010 | - | - | QHG52103 | |
OrthoDB | 1 | 1.010 | - | - | D1395365at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0006199 | |
OrthoInspector | 1 | 1.000 | - | - | oto90033 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_107208 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5730 |
SonicParanoid | 1 | 1.000 | - | - | X4479 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
16 | 15.650 |