DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and nme6

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001123709.1 Gene:nme6 / 100170458 XenbaseID:XB-GENE-969918 Length:179 Species:Xenopus tropicalis


Alignment Length:141 Identity:68/141 - (48%)
Similarity:91/141 - (64%) Gaps:1/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEITLALIKPHVLRNTYAMQQI-RALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSF 64
            :::|||||||..:.|....:.: :.::..||.|:..||:......|:|||.||||:|||.||..|
 Frog    10 LQLTLALIKPDAVANPVISEAVHQKILENNFLIIRHKELHWRSTDSQRFYCEHKGRFFYQRLVEF 74

  Fly    65 MNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALRE 129
            |:|||..|.||..|..:|.||:|:||||||||....|..:|...|::||||..|||||..||.||
 Frog    75 MSSGPMQAYILAHEDAVQLWRNLMGPTKVFRARIVAPGTVRGDLGLTDTRNTTHGSDSVESACRE 139

  Fly   130 ISILFPEFDAA 140
            |:..||||:.:
 Frog   140 ITFFFPEFNTS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 67/136 (49%)
NDPk6 2..135 CDD:239877 64/133 (48%)
nme6NP_001123709.1 NDPk6 11..145 CDD:239877 64/133 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I5003
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4231
Inparanoid 1 1.050 137 1.000 Inparanoid score I4434
OMA 1 1.010 - - QHG52103
OrthoDB 1 1.010 - - D1395365at2759
OrthoFinder 1 1.000 - - FOG0006199
OrthoInspector 1 1.000 - - oto103841
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5730
SonicParanoid 1 1.000 - - X4479
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.