DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and nme9

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_012825581.1 Gene:nme9 / 100158550 XenbaseID:XB-GENE-5862235 Length:620 Species:Xenopus tropicalis


Alignment Length:140 Identity:53/140 - (37%)
Similarity:80/140 - (57%) Gaps:5/140 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEITLALIKPHVL--RNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTS 63
            :|.|||.|||..|  .....::||:   ...|||...||..:::|::|.||.|||||.|:.:|.:
 Frog   448 VEHTLATIKPDALEEHRDEILEQIQ---GTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVN 509

  Fly    64 FMNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALR 128
            :|..||...:||..|..:|:||||:|||....|....|:.:||.:..|..:||.|||.:...|:.
 Frog   510 YMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAME 574

  Fly   129 EISILFPEFD 138
            ::..:|.:.|
 Frog   575 KMKFIFGDID 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 52/137 (38%)
NDPk6 2..135 CDD:239877 51/134 (38%)
nme9XP_012825581.1 TRX_NDPK 11..112 CDD:239246
NDPk 159..295 CDD:238335
NDPk_TX 314..446 CDD:239879
NDPk_TX 449..580 CDD:239879 51/133 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.