DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D6 and nme9

DIOPT Version :9

Sequence 1:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_021334262.1 Gene:nme9 / 100037319 ZFINID:ZDB-GENE-070410-39 Length:665 Species:Danio rerio


Alignment Length:133 Identity:47/133 - (35%)
Similarity:75/133 - (56%) Gaps:3/133 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMN 66
            |.|||:|||........:::|:|   |.|||...|:..:::|::|.||.||:.|.|:.:|..:|.
Zfish   449 EDTLAVIKPDTQHKEEILEEIQA---QGFTISQLKDTILSREMAEEFYKEHREKPFFSQLVDYMC 510

  Fly    67 SGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREIS 131
            .||...|:|..|..:|:||:.:|||...:|..:.|..:||.:......||.|||.:...|.::|.
Zfish   511 RGPCTMLVLTKENAVQEWRAAMGPTDPDQARLTAPESLRARFAKDVLENAVHGSSNTEHADQKIK 575

  Fly   132 ILF 134
            .:|
Zfish   576 FIF 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 47/133 (35%)
NDPk6 2..135 CDD:239877 47/133 (35%)
nme9XP_021334262.1 TRX_NDPK 11..112 CDD:239246
NDPk_TX 161..296 CDD:239879
NDPk_TX 314..446 CDD:239879
NDPk_TX 449..578 CDD:239879 46/131 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.