DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS25 and SPCC1442.19

DIOPT Version :9

Sequence 1:NP_511153.1 Gene:mRpS25 / 32395 FlyBaseID:FBgn0030572 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001343094.1 Gene:SPCC1442.19 / 9407293 PomBaseID:SPCC1442.19 Length:135 Species:Schizosaccharomyces pombe


Alignment Length:137 Identity:27/137 - (19%)
Similarity:52/137 - (37%) Gaps:26/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IRRTLKYLNAGKL--VLKDKVRIFSVNYNTYG-AHHAGARDFVFWNIPQIQFKN----------- 60
            ::::|..:.||.|  .|...::..|:.|:... ..|.||:.||...:|.:.:.|           
pombe     8 LQKSLHKIRAGALGIPLPKHIQEVSIQYSLDSRLGHMGAKKFVKECLPSLYYNNYGLKFNVNHRL 72

  Fly    61 PEVQVLTLKNMTPSPFVRCYFDDGRDMLIDLDSRNRNDIIDHLVKVVGKTREQLDAE---ERLKE 122
            |..|..|...::.:..:..|         |:.|:....|...:.|.:.:...:...|   |..|:
pombe    73 PNDQTPTFSIISNNKVIYSY---------DMRSKQLETISSDIQKALKELHHESSPENIKEAHKQ 128

  Fly   123 SKDNPAN 129
            ....|:|
pombe   129 DYSPPSN 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS25NP_511153.1 L51_S25_CI-B8 40..109 CDD:197984 15/79 (19%)
SPCC1442.19NP_001343094.1 L51_S25_CI-B8 42..112 CDD:322866 15/78 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13274
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.