DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS25 and MRP49

DIOPT Version :9

Sequence 1:NP_511153.1 Gene:mRpS25 / 32395 FlyBaseID:FBgn0030572 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_012754.1 Gene:MRP49 / 853687 SGDID:S000001650 Length:137 Species:Saccharomyces cerevisiae


Alignment Length:126 Identity:33/126 - (26%)
Similarity:58/126 - (46%) Gaps:38/126 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IRRTLKYLNAGKL--------VLKD-------KVRIFSVNYNTYGAHHAGARDFVFWN--IPQIQ 57
            :.:.||:||  |:        :|.|       ::...:.|:|    .|.|||  |||:  :|.:|
Yeast     4 VAQQLKFLN--KISATTRLPQILVDPKKYSGLRLTFQTKNHN----GHMGAR--VFWHNYLPTLQ 60

  Fly    58 FKNPEVQ--VLTLKNMTPSPFVRCYFD----DGRDMLIDLDSRNR------NDIIDHLVKV 106
            |.||.::  |:.:||......|.|..:    :| .::..:|.||:      .|::|.:..|
Yeast    61 FYNPRMKFDVIRIKNEDKQKSVPCKLEILSHEG-SVVETIDMRNKMHEDIMKDLLDKIEHV 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS25NP_511153.1 L51_S25_CI-B8 40..109 CDD:197984 24/81 (30%)
MRP49NP_012754.1 L51_S25_CI-B8 43..119 CDD:197984 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13274
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.