DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS25 and Mrps25

DIOPT Version :9

Sequence 1:NP_511153.1 Gene:mRpS25 / 32395 FlyBaseID:FBgn0030572 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001020579.1 Gene:Mrps25 / 297459 RGDID:1308770 Length:171 Species:Rattus norvegicus


Alignment Length:170 Identity:90/170 - (52%)
Similarity:122/170 - (71%) Gaps:5/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPFMKGREPIRRTLKYLNAGKLVLKDKVRIFSVNYNTYGAHHAGARDFVFWNIPQIQFKNPEVQV 65
            || ||||.||||||:||.:|.:|.|:.|::.:|||||:|....|||.|||:||||||:|||.||:
  Rat     1 MP-MKGRFPIRRTLQYLGSGDVVFKESVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQI 64

  Fly    66 LTLKNMTPSPFVRCYFDDGRDMLIDLDSRNRNDIIDHLVKVVGKTREQLDAEERLKESKDNPANF 130
            :..||||||||:|.|.:.|..:|:|:::::..:|::|:.|::||..|.|..||..|:.:.:|.||
  Rat    65 MLFKNMTPSPFLRFYLESGEQVLVDVETKSNTEIVEHIKKILGKKEETLREEELEKQQRFHPGNF 129

  Fly   131 G---YGCGRHCICEIPGQVPCPGTVPLPDHMRGKILFAPK 167
            |   | |.|.|:||:.|||||||.||||..|.||...|.|
  Rat   130 GPRKY-CLRECMCEVEGQVPCPGLVPLPKEMTGKYKAALK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS25NP_511153.1 L51_S25_CI-B8 40..109 CDD:197984 33/68 (49%)
Mrps25NP_001020579.1 L51_S25_CI-B8 43..107 CDD:197984 33/63 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346120
Domainoid 1 1.000 73 1.000 Domainoid score I9042
eggNOG 1 0.900 - - E1_KOG4079
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11207
Inparanoid 1 1.050 187 1.000 Inparanoid score I3826
OMA 1 1.010 - - QHG48011
OrthoDB 1 1.010 - - D1438394at2759
OrthoFinder 1 1.000 - - FOG0007094
OrthoInspector 1 1.000 - - oto96257
orthoMCL 1 0.900 - - OOG6_108278
Panther 1 1.100 - - LDO PTHR13274
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5182
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.