DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS25 and mrps-25

DIOPT Version :9

Sequence 1:NP_511153.1 Gene:mRpS25 / 32395 FlyBaseID:FBgn0030572 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_500032.1 Gene:mrps-25 / 176926 WormBaseID:WBGene00021920 Length:170 Species:Caenorhabditis elegans


Alignment Length:163 Identity:71/163 - (43%)
Similarity:101/163 - (61%) Gaps:3/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPFMKGREPIRRTLKYLNAGKLVLKDKVRIFSVNYNTYGA-HHAGARDFVFWNIPQIQFKNPEVQ 64
            ||||.|..|:|||..||..||:.|:|.|.:||:.::.... ..:||||||:||..|:|:.||:||
 Worm     1 MPFMHGSMPLRRTFFYLQQGKVKLRDNVNVFSMGFHKNPTPEQSGARDFVYWNWAQLQYHNPKVQ 65

  Fly    65 VLTLKNMTPSPFVRCYFDDGRDMLIDLDSRNRNDIIDHLVKVVGKTREQLDAEERLKE-SKDNPA 128
            ::...:...:||.|.|.:|||::|.|||...|.:|...|.|.:||| |.::..|.|:. :|.|||
 Worm    66 LVKHADKVVTPFARAYLNDGREVLFDLDGMKREEIEKLLAKTLGKT-ELVERREHLESIAKLNPA 129

  Fly   129 NFGYGCGRHCICEIPGQVPCPGTVPLPDHMRGK 161
            :||....|.|:||:.||.||.|.:..|..:.||
 Worm   130 DFGSKNERQCMCEVQGQHPCTGLLRAPQCVTGK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS25NP_511153.1 L51_S25_CI-B8 40..109 CDD:197984 29/69 (42%)
mrps-25NP_500032.1 L51_S25_CI-B8 41..110 CDD:197984 29/68 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162547
Domainoid 1 1.000 59 1.000 Domainoid score I7093
eggNOG 1 0.900 - - E1_KOG4079
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11207
Inparanoid 1 1.050 138 1.000 Inparanoid score I3100
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48011
OrthoDB 1 1.010 - - D1438394at2759
OrthoFinder 1 1.000 - - FOG0007094
OrthoInspector 1 1.000 - - oto18291
orthoMCL 1 0.900 - - OOG6_108278
Panther 1 1.100 - - LDO PTHR13274
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2779
SonicParanoid 1 1.000 - - X5182
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.