DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS25 and mrps25

DIOPT Version :9

Sequence 1:NP_511153.1 Gene:mRpS25 / 32395 FlyBaseID:FBgn0030572 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_031757022.1 Gene:mrps25 / 100494871 XenbaseID:XB-GENE-961634 Length:173 Species:Xenopus tropicalis


Alignment Length:164 Identity:94/164 - (57%)
Similarity:119/164 - (72%) Gaps:5/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPFMKGREPIRRTLKYLNAGKLVLKDKVRIFSVNYNTYGAHHAGARDFVFWNIPQIQFKNPEVQV 65
            || ||||.||||||:||.||:::.|:.|:|.:|||||.|....|||.|||:||||||:|||.||:
 Frog     1 MP-MKGRFPIRRTLQYLQAGEIMFKNNVKIMTVNYNTNGELGEGARKFVFFNIPQIQYKNPWVQI 64

  Fly    66 LTLKNMTPSPFVRCYFDDGRDMLIDLDSRNRNDIIDHLVKVVGKTREQLDAEERLKESKDNPANF 130
            :..||||||||:|.|.|.|..:|:|::.::..:|:.|:.|::|||.|.|.|||:.|..|.|||||
 Frog    65 MMFKNMTPSPFLRFYLDSGEQVLVDIEDKSNTEIVQHVKKILGKTGETLRAEEQAKMVKSNPANF 129

  Fly   131 G---YGCGRHCICEIPGQVPCPGTVPLPDHMRGK 161
            |   |.. |.||||:.||||||..||||..|.||
 Frog   130 GLRKYHL-RECICEVEGQVPCPSKVPLPKEMTGK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS25NP_511153.1 L51_S25_CI-B8 40..109 CDD:197984 34/68 (50%)
mrps25XP_031757022.1 L51_S25_CI-B8 43..108 CDD:197984 34/64 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8856
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11207
Inparanoid 1 1.050 191 1.000 Inparanoid score I3751
OMA 1 1.010 - - QHG48011
OrthoDB 1 1.010 - - D1438394at2759
OrthoFinder 1 1.000 - - FOG0007094
OrthoInspector 1 1.000 - - oto102980
Panther 1 1.100 - - LDO PTHR13274
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2779
SonicParanoid 1 1.000 - - X5182
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.