DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14414 and AT5G52545

DIOPT Version :9

Sequence 1:NP_001285240.1 Gene:CG14414 / 32394 FlyBaseID:FBgn0030571 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001332099.1 Gene:AT5G52545 / 835331 AraportID:AT5G52545 Length:155 Species:Arabidopsis thaliana


Alignment Length:148 Identity:47/148 - (31%)
Similarity:74/148 - (50%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GGGGNPEEARRIWVGNLDSRITDSICIAPYRFQLLKLMQKCGAIEKFDMLFHKGGPMVGQSRGYA 82
            ||..:.:...|::|||||.||.::        .|:|:....|.|...|.|:|..||..|:.||||
plant     4 GGFVDEKGENRLYVGNLDLRINEA--------SLIKMFSPYGKIISEDFLWHTRGPKKGEPRGYA 60

  Fly    83 FVTFAQNEGATNALLKLDGTSVGNRSIAVRLA-----KNIKYDETQKPKPRLDIPALGTGKREEK 142
            |:.::..|.|..|..|:.|.....|.:.||||     ::..:|.:::..|..:......|....:
plant    61 FIQYSLKEEAELAKEKMHGRLACGRPLVVRLASEKHLEDSSHDHSKRSLPEGNRTRFVNGSSSGQ 125

  Fly   143 VSKTEAIRAIEAKLKMLE 160
            :|:.|.:.||:.|||.||
plant   126 MSRDEKVTAIKNKLKALE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14414NP_001285240.1 RRM <22..>126 CDD:223796 34/108 (31%)
RRM_RBM18 28..115 CDD:240801 33/91 (36%)
AT5G52545NP_001332099.1 RRM_RBM18 14..93 CDD:409791 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2463
OMA 1 1.010 - - QHG60257
OrthoDB 1 1.010 - - D1566886at2759
OrthoFinder 1 1.000 - - FOG0005768
OrthoInspector 1 1.000 - - oto2854
orthoMCL 1 0.900 - - OOG6_105828
Panther 1 1.100 - - LDO PTHR21245
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.