DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14414 and PSRP2

DIOPT Version :9

Sequence 1:NP_001285240.1 Gene:CG14414 / 32394 FlyBaseID:FBgn0030571 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001030841.1 Gene:PSRP2 / 824379 AraportID:AT3G52150 Length:253 Species:Arabidopsis thaliana


Alignment Length:111 Identity:35/111 - (31%)
Similarity:56/111 - (50%) Gaps:22/111 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EEARRIWVGNLDSRITDSICIAPYRFQLLKLMQKCGAIEKFDMLFHKGGPMVGQSRGYAFVTFAQ 88
            |.|||:::||:...:|:.        ||.||:::.||:||..:::.|   ..|:||.:.|.|...
plant    73 EAARRVYIGNIPRTVTNE--------QLTKLVEEHGAVEKVQVMYDK---YSGRSRRFGFATMKS 126

  Fly    89 NEGATNALLKLDGTSVGNRSIAVRLAKNIKYDETQKP---KPRLDI 131
            .|.|...:.||:|.:|..|.|.|.:        |:||   .|.|.:
plant   127 VEDANAVVEKLNGNTVEGREIKVNI--------TEKPIASSPDLSV 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14414NP_001285240.1 RRM <22..>126 CDD:223796 33/104 (32%)
RRM_RBM18 28..115 CDD:240801 27/86 (31%)
PSRP2NP_001030841.1 RRM_SF 77..154 CDD:327398 28/95 (29%)
RRM <78..>253 CDD:330708 31/106 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.