DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14414 and Rbm18

DIOPT Version :9

Sequence 1:NP_001285240.1 Gene:CG14414 / 32394 FlyBaseID:FBgn0030571 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_080710.1 Gene:Rbm18 / 67889 MGIID:1915139 Length:190 Species:Mus musculus


Alignment Length:188 Identity:64/188 - (34%)
Similarity:92/188 - (48%) Gaps:29/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GNPEEARRIWVGNLDSRITDSICIAPYRFQLLKLMQKCGAIEKFDMLFHKGGPMVGQSRGYAFVT 85
            |:.:|..|:|:||||.:||:        :.||||:||.|.:::||.||||.|.:.||.|||.||.
Mouse    19 GSLQEGHRLWIGNLDPKITE--------YHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVN 75

  Fly    86 FAQNEGATNALLKLDGTSVGNRSIAVRLA----KNIKYDETQKPKPRLDIPALGTGKREEKVSKT 146
            |...:.|..|:..|:|....::.:.||.|    |...:::..|..|....|:..|...:..:|.|
Mouse    76 FETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPAQSNLSVT 140

  Fly   147 EAIRAIEAKLKMLERQTDDNLELNTAGRGEANVPFIQRYQFNKDRDGSQRYGKSSAPY 204
            ..|:||||||||:....|            |..|....|.:.|..|     .|.:.||
Mouse   141 AKIKAIEAKLKMMAENPD------------AEYPAAPVYSYFKPPD-----KKRTTPY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14414NP_001285240.1 RRM <22..>126 CDD:223796 40/107 (37%)
RRM_RBM18 28..115 CDD:240801 37/90 (41%)
Rbm18NP_080710.1 LSM_int_assoc <26..>189 CDD:330438 62/181 (34%)
RRM_RBM18 26..105 CDD:240801 36/86 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..190 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849746
Domainoid 1 1.000 69 1.000 Domainoid score I9672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12204
Inparanoid 1 1.050 97 1.000 Inparanoid score I5008
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60257
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005768
OrthoInspector 1 1.000 - - oto95337
orthoMCL 1 0.900 - - OOG6_105828
Panther 1 1.100 - - LDO PTHR21245
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8087
SonicParanoid 1 1.000 - - X4747
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.890

Return to query results.
Submit another query.