DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14414 and rbm18

DIOPT Version :9

Sequence 1:NP_001285240.1 Gene:CG14414 / 32394 FlyBaseID:FBgn0030571 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_012823742.1 Gene:rbm18 / 496464 XenbaseID:XB-GENE-489515 Length:190 Species:Xenopus tropicalis


Alignment Length:197 Identity:66/197 - (33%)
Similarity:98/197 - (49%) Gaps:30/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GNPEEARRIWVGNLDSRITDSICIAPYRFQLLKLMQKCGAIEKFDMLFHKGGPMVGQSRGYAFVT 85
            |:.::..|:|:||:|.:||:        :.||||:||.|.:::||.||||.||:.||.|||.||.
 Frog    19 GSLQDGHRLWIGNVDPKITE--------YHLLKLLQKFGKVKQFDFLFHKSGPLEGQPRGYCFVN 75

  Fly    86 FAQNEGATNALLKLDGTSVGNRSIAVRLA-KNIKYDETQKPKPRLDI---PALGTGKREEKVSKT 146
            |.....|..|:..|:|....::.:.||.| ..||..:..|.:..|.|   |:..|...:..:|.:
 Frog    76 FETKAEAERAIHCLNGKMALSKKLVVRWAHAQIKRYDNYKSEKVLPISLEPSSSTEPTQSTLSVS 140

  Fly   147 EAIRAIEAKLKMLERQTDDNLELNTAGRGEANVPFIQRYQFNKDRDGSQRYGKSSAPY-HHQQRP 210
            ..|:||||||||:....|..|            |....|.:.|..:     .:.:||| ...|:.
 Frog   141 AKIKAIEAKLKMMAENPDPLL------------PGQSTYSYFKSNE-----KRKNAPYPKSSQKS 188

  Fly   211 KR 212
            ||
 Frog   189 KR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14414NP_001285240.1 RRM <22..>126 CDD:223796 40/104 (38%)
RRM_RBM18 28..115 CDD:240801 37/87 (43%)
rbm18XP_012823742.1 RRM <1..190 CDD:223796 64/195 (33%)
RRM_RBM18 26..105 CDD:240801 36/86 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10628
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12204
Inparanoid 1 1.050 84 1.000 Inparanoid score I5020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566886at2759
OrthoFinder 1 1.000 - - FOG0005768
OrthoInspector 1 1.000 - - oto105516
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4747
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.